Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smarcd3 Rabbit Polyclonal Antibody (Biotin)

Smarcd3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BAF60, BAF60C, 1500001J14Rik, 2210409C08Rik

UniProt

Q6P9Z1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neugrin (NGRN) (C-term) Rabbit Polyclonal Antibody
AP52872PU-N 400 µL

Neugrin (NGRN) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hybex™ Erlenmeyer Flask, 50ml, case of 12
B3110-50 1 Each

Hybex™ Erlenmeyer Flask, 50ml, case of 12

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-01 24 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-02 48 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-03 96 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
D-Xylo-2-Hexulosonic Acid Butyl Ester
TRC-X750310-25MG 25 mg

D-Xylo-2-Hexulosonic Acid Butyl Ester

Sign In for Pricing
View Details