Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smarcd3 Rabbit Polyclonal Antibody (HRP)

Smarcd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAF60, BAF60C, 1500001J14Rik, 2210409C08Rik

UniProt

Q6P9Z1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRO2/RHOT2 Rabbit Polyclonal Antibody (Biotin)
orb2648895 100 µg

MIRO2/RHOT2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PRDM16 Antibody, Biotin conjugated
MBS7053252-01 0.05 mg

PRDM16 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PRDM16 Antibody, Biotin conjugated
MBS7053252-02 0.1 mg

PRDM16 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PRDM16 Antibody, Biotin conjugated
MBS7053252-03 5x 0.1 mg

PRDM16 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ABHD2, ID (ABHD2, LABH2, Abhydrolase domain-containing protein 2, Lung alpha/beta hydrolase 2, Protein PHPS1-2) (PE) discontinued
031492-PE 200 µL

ABHD2, ID (ABHD2, LABH2, Abhydrolase domain-containing protein 2, Lung alpha/beta hydrolase 2, Protein PHPS1-2) (PE) discontinued

Sign In for Pricing
View Details
SAE1, Control Peptide (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)
149435 50 µg

SAE1, Control Peptide (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)

Sign In for Pricing
View Details