Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smarcd3 Rabbit Polyclonal Antibody (HRP)

Smarcd3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAF60, BAF60C, 1500001J14Rik, 2210409C08Rik

UniProt

Q6P9Z1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT/Tau/PHF-tau Human Monoclonal Antibody (FITC)
orb2974100-01 50 Tests

MAPT/Tau/PHF-tau Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
MAPT/Tau/PHF-tau Human Monoclonal Antibody (FITC)
orb2974100-02 100 Tests

MAPT/Tau/PHF-tau Human Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
PER3 Rabbit Polyclonal Antibody (Cy3)
orb2613276 100 µg

PER3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
BECN1 Protein Vector (Rat) (pPM-C-HA)
PV256132 500 ng

BECN1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
UNC13D (Protein Unc-13 Homolog D, Munc13-4) (MaxLight 405)
MBS6193331-01 0.1 mL

UNC13D (Protein Unc-13 Homolog D, Munc13-4) (MaxLight 405)

Sign In for Pricing
View Details
UNC13D (Protein Unc-13 Homolog D, Munc13-4) (MaxLight 405)
MBS6193331-02 5x 0.1 mL

UNC13D (Protein Unc-13 Homolog D, Munc13-4) (MaxLight 405)

Sign In for Pricing
View Details