Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD1 Rabbit Polyclonal Antibody (FITC)

SMARCD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSS11, Rsc6p, BAF60A, CRACD1

UniProt

Q96GM5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RING finger protein 121 (rnf-121)
MBS7028717-01 0.02 mg

Recombinant RING finger protein 121 (rnf-121)

Sign In for Pricing
View Details
Recombinant RING finger protein 121 (rnf-121)
MBS7028717-02 0.1 mg

Recombinant RING finger protein 121 (rnf-121)

Sign In for Pricing
View Details
Recombinant RING finger protein 121 (rnf-121)
MBS7028717-03 5x 0.1 mg

Recombinant RING finger protein 121 (rnf-121)

Sign In for Pricing
View Details
MECP2 (AUTSX 3, AUTSX3, DKFZp686A24160, Mbd 5, Mbd5, MECP 2, MeCP 2 Protein, MeCP-2 Protein, MeCP2, Mecp2, MECP2_HUMAN, Methyl CpG Binding Protein 2 (Rett Syndrome), Methyl CpG Binding Protein 2, Methyl-CpG-Binding Protein 2, MRX 16, MRX 79, MRX16, MRX79, MRXS 13, MRXS13, MRXSL, PPMX, RS, RTS, RTT, WBP 10, WBP10)
323755 100 µL

MECP2 (AUTSX 3, AUTSX3, DKFZp686A24160, Mbd 5, Mbd5, MECP 2, MeCP 2 Protein, MeCP-2 Protein, MeCP2, Mecp2, MECP2_HUMAN, Methyl CpG Binding Protein 2 (Rett Syndrome), Methyl CpG Binding Protein 2, Methyl-CpG-Binding Protein 2, MRX 16, MRX 79, MRX16, MRX79, MRXS 13, MRXS13, MRXSL, PPMX, RS, RTS, RTT, WBP 10, WBP10)

Sign In for Pricing
View Details
Human Glycogen synthase 2 (GYS2) ELISA Kit
YP-W11376-01 48 Tests

Human Glycogen synthase 2 (GYS2) ELISA Kit

Sign In for Pricing
View Details
Human Glycogen synthase 2 (GYS2) ELISA Kit
YP-W11376-02 96 Tests

Human Glycogen synthase 2 (GYS2) ELISA Kit

Sign In for Pricing
View Details