Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgn2 Rabbit Polyclonal Antibody (HRP)

Hmgn2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hmg17, HMG-17

UniProt

P09602

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058653

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp386 shRNA (UAS) - Lentiviral mouse Zfp386 shRNA (UAS, GFP) (100)
GTR15273345 1 Vial

Lentiviral mouse Zfp386 shRNA (UAS) - Lentiviral mouse Zfp386 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RPS13P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV783153 1.0 µg DNA

RPS13P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit anti-WFS1 Antibody
MBS4508610-01 0.05 mL

Rabbit anti-WFS1 Antibody

Sign In for Pricing
View Details
Rabbit anti-WFS1 Antibody
MBS4508610-02 0.1 mL

Rabbit anti-WFS1 Antibody

Sign In for Pricing
View Details
Rabbit anti-WFS1 Antibody
MBS4508610-03 5x 0.1 mL

Rabbit anti-WFS1 Antibody

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Follicular Lymphoma Variant Translocation 1 (FVT1)
MBS2094567-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Follicular Lymphoma Variant Translocation 1 (FVT1)

Sign In for Pricing
View Details