Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGR1 Rabbit Polyclonal Antibody (FITC)

EGR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268

UniProt

P18146

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EGR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubella Virus Capsid C
PR27126-B 1 Each

Rubella Virus Capsid C

Sign In for Pricing
View Details
Precast SDS-PAGE Gel Plastics 12-well, 4-20%
PGP42012-S-01 10 PCS/Kit

Precast SDS-PAGE Gel Plastics 12-well, 4-20%

Sign In for Pricing
View Details
Precast SDS-PAGE Gel Plastics 12-well, 4-20%
PGP42012-S-02 1 PCK

Precast SDS-PAGE Gel Plastics 12-well, 4-20%

Sign In for Pricing
View Details
Human MS4A1/CD20 MAb (Clone 396444)
MAB4225 100 µg

Human MS4A1/CD20 MAb (Clone 396444)

Sign In for Pricing
View Details
Lentiviral mouse Ddx46 shRNA (UAS) - Lentiviral mouse Ddx46 shRNA (UAS, iRFP) (25)
GTR15169538 1 Vial

Lentiviral mouse Ddx46 shRNA (UAS) - Lentiviral mouse Ddx46 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human cysteinyl aspartate specific proteinases 12, Caspase-12 ELISA Kit
MBS9302935-01 48 Well

Human cysteinyl aspartate specific proteinases 12, Caspase-12 ELISA Kit

Sign In for Pricing
View Details