Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igf2bp1 Rabbit Polyclonal Antibody (FITC)

Igf2bp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IM, Crd, IMP, Zbp, CRD-, IMP1, Zbp1, Crdbp, IMP-1, ZBP-1, CRD-BP, D11Moh4, Neilsen, AL024068, AW549074, D11Moh40, D11Moh45, mir-3063, D11Moh40e, D030026A21Rik

UniProt

O88477

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
orb774884-01 48 Tests

Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
orb774884-02 96 Tests

Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Ginkgolic acid 2-phosphate
T85072-01 10 mg

Ginkgolic acid 2-phosphate

Sign In for Pricing
View Details
Ginkgolic acid 2-phosphate
T85072-02 50 mg

Ginkgolic acid 2-phosphate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Activin A Receptor Type II A (ACVR2A)
MBS2063293-01 0.1 mL

HRP-Linked Polyclonal Antibody to Activin A Receptor Type II A (ACVR2A)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Activin A Receptor Type II A (ACVR2A)
MBS2063293-02 0.2 mL

HRP-Linked Polyclonal Antibody to Activin A Receptor Type II A (ACVR2A)

Sign In for Pricing
View Details