Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igf2bp1 Rabbit Polyclonal Antibody (HRP)

Igf2bp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IM, Crd, IMP, Zbp, CRD-, IMP1, Zbp1, Crdbp, IMP-1, ZBP-1, CRD-BP, D11Moh4, Neilsen, AL024068, AW549074, D11Moh40, D11Moh45, mir-3063, D11Moh40e, D030026A21Rik

UniProt

O88477

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
MBS4501052-01 48 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
MBS4501052-02 96 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
MBS4501052-03 5x 96 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
MBS4501052-04 10x 96 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
Thrap3 Mouse Gene Knockout Kit (CRISPR)
KN517540 1 Kit

Thrap3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPE65 Rabbit pAb, FITC conjugated
orb2892671 100 µL

RPE65 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details