Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a7 Rabbit Polyclonal Antibody (HRP)

Slc9a7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NHE, NHE7, AI450287, 6330509M05R, 6330509M05Rik, A530087D17Rik

UniProt

Q8BLV3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_796327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO16 CRISPRa sgRNA lentivector (set of three targets)(Human)
20311121 3x 1.0µg DNA

FBXO16 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Glycodelin (PAEP) Antibody
abx213124-01 50 µL

Glycodelin (PAEP) Antibody

Sign In for Pricing
View Details
Glycodelin (PAEP) Antibody
abx213124-02 100 µL

Glycodelin (PAEP) Antibody

Sign In for Pricing
View Details
KISS1R Antibody
CSB-PA070035-01 50 µg

KISS1R Antibody

Sign In for Pricing
View Details
KISS1R Antibody
CSB-PA070035-02 100 µg

KISS1R Antibody

Sign In for Pricing
View Details
Lentiviral human PHF13 shRNA (UAS) - Lentiviral human PHF13 shRNA (UAS) plasmid
GTR15345334 1 Vial

Lentiviral human PHF13 shRNA (UAS) - Lentiviral human PHF13 shRNA (UAS) plasmid

Sign In for Pricing
View Details