Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc9a7 Rabbit Polyclonal Antibody (HRP)

Slc9a7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NHE, NHE7, AI450287, 6330509M05R, 6330509M05Rik, A530087D17Rik

UniProt

Q8BLV3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_796327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC12A6 Protein Vector (Human) (pPM-C-HA)
PV057791 500 ng

SLC12A6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Swine IL-8 ELISA Kit
CEK2366 96 Tests

Swine IL-8 ELISA Kit

Sign In for Pricing
View Details
ISCA1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV730090 1.0 µg DNA

ISCA1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
CH12F3 Lig4+/- Knockout B Lymphocyte Cell Line
T3550 1x106 cells / 1.0 mL

CH12F3 Lig4+/- Knockout B Lymphocyte Cell Line

Sign In for Pricing
View Details
CHST13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV655498 1.0 µg DNA

CHST13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ID4 Antibody
E19-3183 100 µg -100 µL

ID4 Antibody

Sign In for Pricing
View Details