Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MUC3B Rabbit Polyclonal Antibody (FITC)

MUC3B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MUC3, MUC3A

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MUC3B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

XP_001125753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Calcyclin Binding Protein (CACYBP) ELISA Kit
abx362027 96 Well

Pig Calcyclin Binding Protein (CACYBP) ELISA Kit

Sign In for Pricing
View Details
Ube2e3 (NM_009454) Mouse Tagged ORF Clone
MR226136 10 µg

Ube2e3 (NM_009454) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EBR4 Protein Vector (Human) (pPB-N-His)
PV074650 500 ng

EBR4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Protein 2, Multiple EGF-like Domains Protein 2, MEGF2, RESDA1) (APC)
124841-APC 100 µL

CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Protein 2, Multiple EGF-like Domains Protein 2, MEGF2, RESDA1) (APC)

Sign In for Pricing
View Details
Mouse Flt-3 Ligand ELISA Kit
orb178673 96 Tests

Mouse Flt-3 Ligand ELISA Kit

Sign In for Pricing
View Details
Olfr676 (NM_147095) Mouse Tagged Lenti ORF Clone
MR213237L3 10 µg

Olfr676 (NM_147095) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details