Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh2 Rabbit Polyclonal Antibody (Biotin)

Aldh2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ahd, Ahd-, Ahd5, ALDHI, Ahd-5, AHD-M1, ALDH-E2

UniProt

P47738

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit
MBS9910172-01 48 Well

Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit
MBS9910172-02 96 Well

Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit
MBS9910172-03 5x 96 Well

Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit
MBS9910172-04 10x 96 Well

Sheep Serine/Threonine-Protein Kinase PAK 6 (PAK6) ELISA Kit

Sign In for Pricing
View Details
Research Grade Anti-Human SERPINE1/PAI-1 (CT140)
DHC13902 100 μg

Research Grade Anti-Human SERPINE1/PAI-1 (CT140)

Sign In for Pricing
View Details
HMGCL Antibody
orb1266386 400 μl

HMGCL Antibody

Sign In for Pricing
View Details