Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh2 Rabbit Polyclonal Antibody (HRP)

Aldh2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ahd, Ahd-, Ahd5, ALDHI, Ahd-5, AHD-M1, ALDH-E2

UniProt

P47738

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enolase 3 antibody
70R-1218 100 ug

Enolase 3 antibody

Sign In for Pricing
View Details
MON1A CRISPRa sgRNA lentivector (set of three targets)(Mouse)
30305124 3x 1.0µg DNA

MON1A CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
FAST Polyclonal Antibody
E20-71678 100 µg

FAST Polyclonal Antibody

Sign In for Pricing
View Details
Saquayamycin B1
sc-364135 500 µg

Saquayamycin B1

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-01 24 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-02 48 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details