Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh2 Rabbit Polyclonal Antibody (HRP)

Aldh2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ahd, Ahd-, Ahd5, ALDHI, Ahd-5, AHD-M1, ALDH-E2

UniProt

P47738

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAP Antibody
E38QA4614 100 µL

GRAP Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Vinculin Antibody (VCL/2573) [Alexa Fluor 700]
NBP2-79941AF700 0.1 mL

Mouse Monoclonal Vinculin Antibody (VCL/2573) [Alexa Fluor 700]

Sign In for Pricing
View Details
FAM78A Human Gene Knockout Kit (CRISPR)
KN408190 1 Kit

FAM78A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 116
T200145-01 10 mg

E3 Ligase Ligand-linker Conjugate 116

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 116
T200145-02 50 mg

E3 Ligase Ligand-linker Conjugate 116

Sign In for Pricing
View Details
Lentiviral mouse Nat8f7 shRNA (UAS) - Lentiviral mouse Nat8f7 shRNA (UAS, RFP) plasmid
GTR15269917 1 Vial

Lentiviral mouse Nat8f7 shRNA (UAS) - Lentiviral mouse Nat8f7 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details