Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP25 Rabbit Polyclonal Antibody (Biotin)

ARHGAP25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KAIA0053, HEL-S-308

UniProt

P42331

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F-actin Staining Kit (Green Fluorescence)
orb1173165-01 50 Tests

F-actin Staining Kit (Green Fluorescence)

Sign In for Pricing
View Details
F-actin Staining Kit (Green Fluorescence)
orb1173165-02 300 Tests

F-actin Staining Kit (Green Fluorescence)

Sign In for Pricing
View Details
F-actin Staining Kit (Green Fluorescence)
orb1173165-03 1000 Tests

F-actin Staining Kit (Green Fluorescence)

Sign In for Pricing
View Details
Recombinant Hahella chejuensis Lipid A export ATP-binding/permease protein MsbA (msbA)
orb2913665-01 20 µg

Recombinant Hahella chejuensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Recombinant Hahella chejuensis Lipid A export ATP-binding/permease protein MsbA (msbA)
orb2913665-02 100 µg

Recombinant Hahella chejuensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor   monoclonal antibody
MB10274 50ul

Angiotensin II Type 1 Receptor monoclonal antibody

Sign In for Pricing
View Details