Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP25 Rabbit Polyclonal Antibody (HRP)

ARHGAP25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KAIA0053, HEL-S-308

UniProt

P42331

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diamond Nanopowder, 4-7nm
19151 1 g

Diamond Nanopowder, 4-7nm

Sign In for Pricing
View Details
RPL17, CT (RPL17, 60S ribosomal protein L17, 60S ribosomal protein L23, PD-1) (APC) discontinued
041195-APC 200 µL

RPL17, CT (RPL17, 60S ribosomal protein L17, 60S ribosomal protein L23, PD-1) (APC) discontinued

Sign In for Pricing
View Details
Bsx 3'UTR GFP Stable Cell Line
TU251442 1.0 mL

Bsx 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Zebrafish ASH2L Rabbit Polyclonal Antibody (Fluoro488)
orb3091431 100 µg

Zebrafish ASH2L Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Guinea Pig Stomach Total Protein
GT-302 1 mg

Guinea Pig Stomach Total Protein

Sign In for Pricing
View Details
Anti-FSH Receptor/FSHR Antibody Picoband® Fluoro488 Conjugated
PB10065-Fluoro488 100 µg/Vial

Anti-FSH Receptor/FSHR Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details