Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Romo1 Rabbit Polyclonal Antibody (FITC)

Romo1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI853864, 2010100O12Rik

UniProt

A2AHC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001108548

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1506 CRISPR Activation Plasmid (m)
sc-434257-ACT 20 µg

Olfr1506 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
TFB2M Protein Vector (Human) (pPB-N-His)
PV041782 500 ng

TFB2M Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PTK2B (PTK2B Protein Tyrosine Kinase 2 beta, CADTK, CAKB, FADK2, FAK2, FRNK, PKB, PTK, PYK2, RAFTK) (MaxLight 490)
MBS6208138-01 0.1 mL

PTK2B (PTK2B Protein Tyrosine Kinase 2 beta, CADTK, CAKB, FADK2, FAK2, FRNK, PKB, PTK, PYK2, RAFTK) (MaxLight 490)

Sign In for Pricing
View Details
PTK2B (PTK2B Protein Tyrosine Kinase 2 beta, CADTK, CAKB, FADK2, FAK2, FRNK, PKB, PTK, PYK2, RAFTK) (MaxLight 490)
MBS6208138-02 5x 0.1 mL

PTK2B (PTK2B Protein Tyrosine Kinase 2 beta, CADTK, CAKB, FADK2, FAK2, FRNK, PKB, PTK, PYK2, RAFTK) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-TBK1/NAK (Ser172) (D52C2) XP® Rabbit Monoclonal Antibody
CST 5483S 100 µL

Phospho-TBK1/NAK (Ser172) (D52C2) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MOV10 Protein Vector (Mouse) (pPM-C-His)
PV201621 500 ng

MOV10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details