Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Romo1 Rabbit Polyclonal Antibody (HRP)

Romo1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI853864, 2010100O12Rik

UniProt

A2AHC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001108548

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT
E1347Hu-01 48 Well

Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT

Sign In for Pricing
View Details
Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT
E1347Hu-02 96 Well

Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT

Sign In for Pricing
View Details
Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT
E1347Hu-03 5x 96 Tests

Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT

Sign In for Pricing
View Details
Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT
E1347Hu-04 10x 96 Tests

Human gamma glutamyl transpeptidase 1, GGT1 ELISA KIT

Sign In for Pricing
View Details
Dtwd2 AAV siRNA Pooled Vector
18647166 1.0 µg

Dtwd2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Tbce Pre-designed siRNA Set A
SI114321A 1 Each

Mouse Tbce Pre-designed siRNA Set A

Sign In for Pricing
View Details