Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPS Rabbit Polyclonal Antibody (Biotin)

CAPS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAPS1

UniProt

Q13938

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 490)
MBS6253818-01 0.1 mL

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 490)

Sign In for Pricing
View Details
Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 490)
MBS6253818-02 5x 0.1 mL

Dectin-1 (C-type Lectin Domain Family 7 Member A, Dendritic Cell-associated C-type Lectin 1, DC-associated C-type Lectin 1, Beta-glucan Receptor, beta-GR, C-type Lectin Superfamily Member 12, CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082) (MaxLight 490)

Sign In for Pricing
View Details
BCDIN3D Protein Vector (Human) (pPM-N-D-C-His)
PV326473 500 ng

BCDIN3D Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Phosphotyrosine (Agarose) discontinued
P4075-37 500 µL

Phosphotyrosine (Agarose) discontinued

Sign In for Pricing
View Details
Maltase Glucoamylase, Intestinal (MGA) BioAssayTM ELISA Kit (Human)
026663-01 48 Tests

Maltase Glucoamylase, Intestinal (MGA) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Maltase Glucoamylase, Intestinal (MGA) BioAssayTM ELISA Kit (Human)
026663-02 96 Tests

Maltase Glucoamylase, Intestinal (MGA) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details