Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST11 Rabbit Polyclonal Antibody (HRP)

CST11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SC13, CST8L, CTES2, dJ322G13.6

UniProt

Q9H112

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_570612

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free
orb1179045-01 5 µg

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free
orb1179045-02 20 µg

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free
orb1179045-03 100 µg

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free
orb1179045-04 500 µg

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free
orb1179045-05 1 mg

Recombinant IL-36 beta (Interleukin-36 beta), Human, Animal-Free

Sign In for Pricing
View Details
REPIN1 Antibody
OACD06982-100UL 100 µL

REPIN1 Antibody

Sign In for Pricing
View Details