Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP2 Rabbit Polyclonal Antibody (HRP)

FKBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKBP13, PPIase, FKBP-13

UniProt

P26885

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFκB-p65 (Phospho-Ser276) Antibody
RDSA62015 100 µL

NFκB-p65 (Phospho-Ser276) Antibody

Sign In for Pricing
View Details
Human SPDYA activation kit by CRISPRa
GA116694 1 Kit

Human SPDYA activation kit by CRISPRa

Sign In for Pricing
View Details
Drg1 Rat shRNA Lentiviral Particle (Locus ID 305470)
TL701335V 500 µL Each

Drg1 Rat shRNA Lentiviral Particle (Locus ID 305470)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Protein psiE (psiE)
orb2921326-01 20 µg

Recombinant Salmonella typhimurium Protein psiE (psiE)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Protein psiE (psiE)
orb2921326-02 100 µg

Recombinant Salmonella typhimurium Protein psiE (psiE)

Sign In for Pricing
View Details
CEACAM16 Antibody - middle region : HRP (ARP44865_P050-HRP)
ARP44865_P050-HRP 100 µL

CEACAM16 Antibody - middle region : HRP (ARP44865_P050-HRP)

Sign In for Pricing
View Details