Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP2 Rabbit Polyclonal Antibody (HRP)

FKBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FKBP13, PPIase, FKBP-13

UniProt

P26885

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Prostaglandin E Synthase Antibody [Alexa Fluor 594]
NBP2-99619AF594 0.1 mL

Rabbit Polyclonal Prostaglandin E Synthase Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
PI3 kinase p150 Monoclonal Antibody, PE-Cy5 Conjugated
bsm-63077R-PE-Cy5 100 µL

PI3 kinase p150 Monoclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H+L) pAb
E40SA2149 100 µL

Goat Anti-Mouse IgG (H+L) pAb

Sign In for Pricing
View Details
SRPK3-set siRNA/shRNA/RNAi Lentivector (Human)
45493091 4x 500 ng

SRPK3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rabbit anti-EPHA4 Antibody
YLD2844-01 50 µL

Rabbit anti-EPHA4 Antibody

Sign In for Pricing
View Details
Rabbit anti-EPHA4 Antibody
YLD2844-02 100 µL

Rabbit anti-EPHA4 Antibody

Sign In for Pricing
View Details