Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fntb Rabbit Polyclonal Antibody (HRP)

Fntb Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC105303

UniProt

Q02293

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fntb

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742031

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a) [Alexa Fluor 532]
NBP2-80870AF532 0.2 mL

Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a) [Alexa Fluor 532]

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC14A1 (Solute carrier family 14 member 1 (Kidd blood group)) Expressed in vitro E.coli expression system, Full Length
MPX4069K Each

Magic™ Membrane Protein Human SLC14A1 (Solute carrier family 14 member 1 (Kidd blood group)) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
MAG (NM_002361) Human Tagged ORF Clone Lentiviral Particle
RC208754L3V 200 µL

MAG (NM_002361) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CLCNKA ORF Vector (Human) (pORF)
ORF017438 1.0 µg DNA

CLCNKA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human IL-20/Interleukin-20 ELISA Kit PicoKine®, Carrier-free
EK0599-carrier-free 96 Well With Removable Strips

Human IL-20/Interleukin-20 ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
INSR (Ab-1375) Antibody
CSB-PA945193 100 µL

INSR (Ab-1375) Antibody

Sign In for Pricing
View Details