Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX4 Rabbit Polyclonal Antibody (HRP)

GPX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx

UniProt

P36969

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_002076

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)
orb3032377-01 24 Tests

Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)

Sign In for Pricing
View Details
Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)
orb3032377-02 96 Tests

Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)

Sign In for Pricing
View Details
Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)
orb3032377-03 96 Tests

Strand-Specific RNA Library Prep Kit (dNTP) (Premix and Sealing Version)

Sign In for Pricing
View Details
Lentiviral mouse Surf4 shRNA (UAS) - Lentiviral mouse Surf4 shRNA (UAS, iRFP) plasmid
GTR15219412 1 Vial

Lentiviral mouse Surf4 shRNA (UAS) - Lentiviral mouse Surf4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
DLX5 (Distal-less Homeobox 5) (MaxLight 405)
MBS6195240-01 0.1 mL

DLX5 (Distal-less Homeobox 5) (MaxLight 405)

Sign In for Pricing
View Details
DLX5 (Distal-less Homeobox 5) (MaxLight 405)
MBS6195240-02 5x 0.1 mL

DLX5 (Distal-less Homeobox 5) (MaxLight 405)

Sign In for Pricing
View Details