Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY4B Rabbit Polyclonal Antibody (FITC)

MINDY4B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C3orf76, FAM188B2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC646951

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_935009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Tbj51 Antibody [Janelia Fluor 549]
NBP3-18235JF549 0.1 mL

Rabbit Polyclonal Tbj51 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal CXCR2/IL-8RB Antibody (866614) [FITC]
FAB8110F 0.1 mL

Mouse Monoclonal CXCR2/IL-8RB Antibody (866614) [FITC]

Sign In for Pricing
View Details
Porcine Orosomucoid (ORM) ELISA Kit
NSL0286Po 96 Tests

Porcine Orosomucoid (ORM) ELISA Kit

Sign In for Pricing
View Details
FGF-17 Rabbit Polyclonal Antibody
E53P06490 100 µL

FGF-17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Trk-A/NTRK1 Protein
E900088P 10 µg

Recombinant Human Trk-A/NTRK1 Protein

Sign In for Pricing
View Details
AGN 205327
BUP22899-01 10 mg

AGN 205327

Sign In for Pricing
View Details