Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY4B Rabbit Polyclonal Antibody (FITC)

MINDY4B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C3orf76, FAM188B2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC646951

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_935009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNP 32 protein
30-1059 500 ug

BNP 32 protein

Sign In for Pricing
View Details
TAF12 ORF Vector (Human) (pORF)
ORF010282 1.0 µg DNA

TAF12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb
A26526-01 50 Tests

ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb

Sign In for Pricing
View Details
ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb
A26526-02 100 Tests

ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb

Sign In for Pricing
View Details
ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb
A26526-03 200 Tests

ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb

Sign In for Pricing
View Details
ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb
A26526-04 500 Tests

ABflo® 610 Rabbit anti-Mouse FcγRI/CD64 mAb

Sign In for Pricing
View Details