Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Platelet factor 4 (PF4)

Product Specifications

Product Name Alternative

(PF-4) (C-X-C motif chemokine 4)

Abbreviation

Recombinant Pig PF4 protein

Gene Name

PF4

UniProt

P30034

Expression Region

1-90aa

Organism

Sus scrofa (Pig)

Target Sequence

QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA

Tag

N-terminal mFc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.7 kDa

References & Citations

"The complete primary structure of glycosylated porcine platelet factor 4." Proudfoot A.E.I., Magnenat E., Haley T.M., Maione T.E., Wells T.N.C. Eur. J. Biochem. 228:658-664 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-02 0.1 mg (E-Coli)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-03 0.02 mg (Yeast)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-05 0.02 mg (Baculovirus)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1082705-06 1 mg (E-Coli)

Recombinant Clostridium botulinum DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details