Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFB Rabbit Polyclonal Antibody (HRP)

PDGFB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2

UniProt

P01127

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_002599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD8a/Lyt2 Antibody
E55A06248 100 µg

Mouse CD8a/Lyt2 Antibody

Sign In for Pricing
View Details
Rat Neural Cell Adhesion Molecule ELISA Kit
MBS752333-01 48 Well

Rat Neural Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Rat Neural Cell Adhesion Molecule ELISA Kit
MBS752333-02 96 Well

Rat Neural Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Rat Neural Cell Adhesion Molecule ELISA Kit
MBS752333-03 5x 96 Well

Rat Neural Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Rat Neural Cell Adhesion Molecule ELISA Kit
MBS752333-04 10x 96 Well

Rat Neural Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details
Neurotrimin Rabbit Polyclonal Antibody
E28PT3077 100 µL

Neurotrimin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details