Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAP1 Rabbit Polyclonal Antibody (Biotin)

PRAP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UPA, PRO1195

UniProt

Q96NZ9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033413

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPG2 Antibody, Biotin conjugated
CSB-PA011704LD01HU-01 50 µg

IMPG2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
IMPG2 Antibody, Biotin conjugated
CSB-PA011704LD01HU-02 100 µg

IMPG2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (Biotin)
125002-Biotin 100 µL

CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (Biotin)

Sign In for Pricing
View Details
Hexa (NM_010421) Mouse Tagged Lenti ORF Clone
MR208464L3 10 µg

Hexa (NM_010421) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Inhibitor mmu-miR-30e-5p AAV miRNA Vector
Amm3054800 500 ng

Inhibitor mmu-miR-30e-5p AAV miRNA Vector

Sign In for Pricing
View Details
CD4 (B486A1) : m-IgGκ BP-HRP Bundle
sc-533923 1 Kit

CD4 (B486A1) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details