Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAP1 Rabbit Polyclonal Antibody (HRP)

PRAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UPA, PRO1195

UniProt

Q96NZ9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033413

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ccdc155 shRNA (UAS) - Lentiviral mouse Ccdc155 shRNA (UAS, RFP) plasmid
GTR15125557 1 Vial

Lentiviral mouse Ccdc155 shRNA (UAS) - Lentiviral mouse Ccdc155 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Sodium Perborate Monohydrate 95% Extrapure
2475B 00500 500 mg

Sodium Perborate Monohydrate 95% Extrapure

Sign In for Pricing
View Details
ZFP64 Protein Vector (Human) (pPM-C-His)
PV047180 500 ng

ZFP64 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PER1 Rabbit Polyclonal Antibody
orb574959 100 µL

PER1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Methyl 3- (methylamino) oxolane-3-carboxylate
TDC23915-01 50 mg

Methyl 3- (methylamino) oxolane-3-carboxylate

Sign In for Pricing
View Details
Methyl 3- (methylamino) oxolane-3-carboxylate
TDC23915-02 0.5 g

Methyl 3- (methylamino) oxolane-3-carboxylate

Sign In for Pricing
View Details