Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCRN2 Rabbit Polyclonal Antibody (HRP)

SCRN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ses2

UniProt

Q96FV2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SCRN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612364

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3gat1 3'UTR Luciferase Stable Cell Line
TU201174 1.0 mL

B3gat1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit
MBS9900781-01 48 Well

Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit
MBS9900781-02 96 Well

Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit
MBS9900781-03 5x 96 Well

Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit

Sign In for Pricing
View Details
Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit
MBS9900781-04 10x 96 Well

Hamster Serine/Threonine-Protein Kinase N3 (PKN3) ELISA Kit

Sign In for Pricing
View Details
GADD45A, NT (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45)
G1017-19A 200 µL

GADD45A, NT (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45)

Sign In for Pricing
View Details