Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ofd1 Rabbit Polyclonal Antibody (HRP)

Ofd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562231

UniProt

D3ZUD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQSTMPHKCDDVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLVHELMHP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

112kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Soybean Agglutinin (SBA, Glycine max) (Agarose)
MBS656718-01 2 mL

Soybean Agglutinin (SBA, Glycine max) (Agarose)

Sign In for Pricing
View Details
Soybean Agglutinin (SBA, Glycine max) (Agarose)
MBS656718-02 5x 2 mL

Soybean Agglutinin (SBA, Glycine max) (Agarose)

Sign In for Pricing
View Details
Human RPP30 Recombinant Protein
PROTP78346-20ug 20 µg

Human RPP30 Recombinant Protein

Sign In for Pricing
View Details
Rabbit F(ab')2 Anti-Mouse IgG (H+L), Human ads-AP
MBS674861-01 1 mL

Rabbit F(ab')2 Anti-Mouse IgG (H+L), Human ads-AP

Sign In for Pricing
View Details
Rabbit F(ab')2 Anti-Mouse IgG (H+L), Human ads-AP
MBS674861-02 5x 1 mL

Rabbit F(ab')2 Anti-Mouse IgG (H+L), Human ads-AP

Sign In for Pricing
View Details
SPACA5, ID (SPACA5, LYZL5, SPACA5A, Sperm acrosome-associated protein 5, Lysozyme-like protein 5, Sperm-specific lysozyme-like protein X)
042192 200 µL

SPACA5, ID (SPACA5, LYZL5, SPACA5A, Sperm acrosome-associated protein 5, Lysozyme-like protein 5, Sperm-specific lysozyme-like protein X)

Sign In for Pricing
View Details