Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC4 Rabbit Polyclonal Antibody (Biotin)

ARMC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gudu, ARMC4, CILD23

UniProt

Q5T2S8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_060546

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST7 Protein Vector (Mouse) (pPM-C-His)
PV234429 500 ng

ST7 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human Collagen alpha-1(2) chain,COL2A1 ELISA KIT
JOT-EK5067Hu-01 48 Well

Human Collagen alpha-1(2) chain,COL2A1 ELISA KIT

Sign In for Pricing
View Details
Human Collagen alpha-1(2) chain,COL2A1 ELISA KIT
JOT-EK5067Hu-02 96 Well

Human Collagen alpha-1(2) chain,COL2A1 ELISA KIT

Sign In for Pricing
View Details
HEXIM1, ID (HEXIM1, CLP1, EDG1, HIS1, MAQ1, Protein HEXIM1, Cardiac lineage protein 1, Estrogen down-regulated gene 1 protein, Hexamethylene bis-acetamide-inducible protein 1, Menage a quatre protein 1) (FITC) discontinued
036522-FITC 200 µL

HEXIM1, ID (HEXIM1, CLP1, EDG1, HIS1, MAQ1, Protein HEXIM1, Cardiac lineage protein 1, Estrogen down-regulated gene 1 protein, Hexamethylene bis-acetamide-inducible protein 1, Menage a quatre protein 1) (FITC) discontinued

Sign In for Pricing
View Details
Rat Adrenocorticotropic Hormone Receptor (ACTHR) ELISA Kit
YP-W35867-01 48 Tests

Rat Adrenocorticotropic Hormone Receptor (ACTHR) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenocorticotropic Hormone Receptor (ACTHR) ELISA Kit
YP-W35867-02 96 Tests

Rat Adrenocorticotropic Hormone Receptor (ACTHR) ELISA Kit

Sign In for Pricing
View Details