Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC4 Rabbit Polyclonal Antibody (FITC)

ARMC4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gudu, ARMC4, CILD23

UniProt

Q5T2S8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_060546

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr1b7 Mouse Gene Knockout Kit (CRISPR)
KN501085 1 Kit

Akr1b7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AATF (Apoptosis Antagonizing Transcription Factor, CHE1, DED, Rb-binding protein Che-1)
361947 200 µL

AATF (Apoptosis Antagonizing Transcription Factor, CHE1, DED, Rb-binding protein Che-1)

Sign In for Pricing
View Details
LINC00632 Human shRNA Lentiviral Particle (Locus ID 286411)
TL320183V 500 µL Each

LINC00632 Human shRNA Lentiviral Particle (Locus ID 286411)

Sign In for Pricing
View Details
Human ANXA5 Pre-designed siRNA Set B
SI000787B 1 Each

Human ANXA5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal Collagen I alpha 1 Antibody [mFluor Violet 450 SE]
NBP1-77458MFV450 0.1 mL

Rabbit Polyclonal Collagen I alpha 1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Hep C NS3 (281)
sc-52806 100 µg/mL

Hep C NS3 (281)

Sign In for Pricing
View Details