Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC2 Rabbit Polyclonal Antibody (HRP)

ARPC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARC34, PRO2446, p34-Arc, PNAS-139

UniProt

O15144

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)
207690 200 µL

GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)

Sign In for Pricing
View Details
PCNA (PC10), CF640R conjugate, 0.1mg/mL
BNC400467-500 1x 500 µL

PCNA (PC10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal PDE1C Antibody
NB300-672-0.025mg 0.025 mg

Rabbit Polyclonal PDE1C Antibody

Sign In for Pricing
View Details
Lentiviral human RCC1 sgRNA gene knockout kit - Lentiviral human RCC1 sgRNA gene knockout kit (100)
GTR15400480 1 Vial

Lentiviral human RCC1 sgRNA gene knockout kit - Lentiviral human RCC1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rabbit Polyclonal RAC3 Antibody
NBP2-32058 0.1 mL

Rabbit Polyclonal RAC3 Antibody

Sign In for Pricing
View Details
TGFa Antibody
V2885-20UG 20 µg

TGFa Antibody

Sign In for Pricing
View Details