Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Banf2 Rabbit Polyclonal Antibody (Biotin)

Banf2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Baf-L, Gm115, Baf-like, 4930517K23Rik

UniProt

Q8BVR0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNKAYVLLGQFL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_997158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS607063 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (FITC)
127182-FITC 100 µL

GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (FITC)

Sign In for Pricing
View Details
Cyp11b2 3'UTR Luciferase Stable Cell Line
TU104629 1.0 mL

Cyp11b2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal Septin-10 Antibody [DyLight 350]
NBP2-44287UV 0.1 mL

Rabbit Polyclonal Septin-10 Antibody [DyLight 350]

Sign In for Pricing
View Details
Rabbit Anti-Human VPS51 pAb
PA9299-01 50 μL

Rabbit Anti-Human VPS51 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human VPS51 pAb
PA9299-02 100 μL

Rabbit Anti-Human VPS51 pAb

Sign In for Pricing
View Details