Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALR3 Rabbit Polyclonal Antibody (HRP)

CALR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CRT2, CT93, CMH19

UniProt

Q96L12

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CALR3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659483

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TMEM25 Protein (His Tag)
PKSH030565 100 µg

Recombinant Human TMEM25 Protein (His Tag)

Sign In for Pricing
View Details
Rab3il1 Mouse Gene Knockout Kit (CRISPR)
KN514369 1 Kit

Rab3il1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638426 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), CF405S conjugate, 0.1mg/mL
BNC041013-500 1x 500 µL

Muscle Specific Actin (HHF35 + MSA/953), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS637106 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
PAI1 (SERPINE1) Human Gene Knockout Kit (CRISPR)
KN402085 1 Kit

PAI1 (SERPINE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details