Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZA3 Rabbit Polyclonal Antibody (Biotin)

CAPZA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gsg3, CAPPA3, HEL-S-86

UniProt

Q96KX2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_201585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gamma-Aminobutyric Acid Type B Receptor Subunit 1 (Gabbr1) Antibody (PE)
abx444376 100 µg

Gamma-Aminobutyric Acid Type B Receptor Subunit 1 (Gabbr1) Antibody (PE)

Sign In for Pricing
View Details
GPR31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0890306 1.0 µg DNA

GPR31 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Serpina6 (NM_007618) Mouse Tagged Lenti ORF Clone
MR206224L4 10 µg

Serpina6 (NM_007618) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tumor Necrosis Factor α-induced protein 3 (TNFAIP3) Mouse ELISA Kit
H9344 96 Tests

Tumor Necrosis Factor α-induced protein 3 (TNFAIP3) Mouse ELISA Kit

Sign In for Pricing
View Details
Edonerpic maleate 200mg
A16934-200 200 mg

Edonerpic maleate 200mg

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 (LRP5)
MBS2164213-01 0.1 mL

PE-Linked Monoclonal Antibody to Low Density Lipoprotein Receptor Related Protein 5 (LRP5)

Sign In for Pricing
View Details