Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZA3 Rabbit Polyclonal Antibody (HRP)

CAPZA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gsg3, CAPPA3, HEL-S-86

UniProt

Q96KX2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_201585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKS1 Polyclonal Antibody, FITC Conjugated
bs-5745R-FITC-01 20 µL

CKS1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CKS1 Polyclonal Antibody, FITC Conjugated
bs-5745R-FITC-02 100 µL

CKS1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Skip (D-5) Alexa Fluor® 790
sc-393856 AF790 200 µg/mL

Skip (D-5) Alexa Fluor® 790

Sign In for Pricing
View Details
TDPX2 sgRNA CRISPR Lentivector (Human) (Target 2)
K2354403 1.0 µg DNA

TDPX2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
POMT2 Adenovirus (Rat)
37225056 1.0 mL

POMT2 Adenovirus (Rat)

Sign In for Pricing
View Details
CAMKV Rabbit Polyclonal Antibody (HRP)
orb2099816 100 µL

CAMKV Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details