Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZA3 Rabbit Polyclonal Antibody (HRP)

CAPZA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gsg3, CAPPA3, HEL-S-86

UniProt

Q96KX2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CAPZA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_201585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRTP1 Rabbit Polyclonal Antibody
orb312254-01 50 μL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody
orb312254-02 100 µL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody
orb312254-03 200 µL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMPD3 Recombinant Protein (Mouse)
RP174026 100 µg

SMPD3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human ROBO4 Alexa Fluor 350 Antibody (Clone 265703)
FAB2454U-100UG 100 µg

Human ROBO4 Alexa Fluor 350 Antibody (Clone 265703)

Sign In for Pricing
View Details
MARVELD1 Protein Vector (Human) (pPB-C-His)
PV093358 500 ng

MARVELD1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details