Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYL1 Rabbit Polyclonal Antibody (Biotin)

CRYL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GDH, HEL30, gul3DH, lambda-CRY

UniProt

Q9Y2S2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRYL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_057058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP7 Double Nickase Plasmid (m)
sc-427262-NIC 20 µg

THAP7 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Human Neuregulin 2 ELISA Kit
MBS094390-01 48 Well

Human Neuregulin 2 ELISA Kit

Sign In for Pricing
View Details
Human Neuregulin 2 ELISA Kit
MBS094390-02 96 Well

Human Neuregulin 2 ELISA Kit

Sign In for Pricing
View Details
Human Neuregulin 2 ELISA Kit
MBS094390-03 5x 96 Well

Human Neuregulin 2 ELISA Kit

Sign In for Pricing
View Details
Human Neuregulin 2 ELISA Kit
MBS094390-04 10x 96 Well

Human Neuregulin 2 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ptpn6 shRNA (UAS) - Lentiviral mouse Ptpn6 shRNA (UAS, RFP) (100)
GTR15197604 1 Vial

Lentiviral mouse Ptpn6 shRNA (UAS) - Lentiviral mouse Ptpn6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details