Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHD2 Rabbit Polyclonal Antibody (HRP)

EFHD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SWS1

UniProt

Q96C19

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gart shRNA (UAS) - Lentiviral mouse Gart shRNA (UAS, RFP) (100)
GTR15295731 1 Vial

Lentiviral mouse Gart shRNA (UAS) - Lentiviral mouse Gart shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ZFAND2A Protein Vector (Human) (pPM-C-HA)
50818021 500 ng

ZFAND2A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MWCNT-Ni Type 1 Carbon Nanotubes Multi Walled, Nickel coated, Length 10-30 micron, OD 5-20nm, 98%
58908-01 1 g

MWCNT-Ni Type 1 Carbon Nanotubes Multi Walled, Nickel coated, Length 10-30 micron, OD 5-20nm, 98%

Sign In for Pricing
View Details
MWCNT-Ni Type 1 Carbon Nanotubes Multi Walled, Nickel coated, Length 10-30 micron, OD 5-20nm, 98%
58908-02 5 g

MWCNT-Ni Type 1 Carbon Nanotubes Multi Walled, Nickel coated, Length 10-30 micron, OD 5-20nm, 98%

Sign In for Pricing
View Details
APC anti-human FPR1
GT16213 25 Tests

APC anti-human FPR1

Sign In for Pricing
View Details
pDNR-LIB-PMS1 Plasmid
PVT27275 2 µg

pDNR-LIB-PMS1 Plasmid

Sign In for Pricing
View Details