Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ20433 Rabbit Polyclonal Antibody (Biotin)

FLJ20433 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nbr, mut-7

UniProt

Q8N9H8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Goat, Human

Tested Applications

WB

NCBI Accession Number

NP_060290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHACTR3, NT (PHACTR3, C20orf101, SCAPIN1, Phosphatase and actin regulator 3, Scaffold-associated PP1-inhibiting protein) (MaxLight 490)
MBS6333217-01 0.1 mL

PHACTR3, NT (PHACTR3, C20orf101, SCAPIN1, Phosphatase and actin regulator 3, Scaffold-associated PP1-inhibiting protein) (MaxLight 490)

Sign In for Pricing
View Details
PHACTR3, NT (PHACTR3, C20orf101, SCAPIN1, Phosphatase and actin regulator 3, Scaffold-associated PP1-inhibiting protein) (MaxLight 490)
MBS6333217-02 5x 0.1 mL

PHACTR3, NT (PHACTR3, C20orf101, SCAPIN1, Phosphatase and actin regulator 3, Scaffold-associated PP1-inhibiting protein) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant HHV2/HSV2 gD/US6 Protein, C-His
orb3057277-01 50 µg

Recombinant HHV2/HSV2 gD/US6 Protein, C-His

Sign In for Pricing
View Details
Recombinant HHV2/HSV2 gD/US6 Protein, C-His
orb3057277-02 100 µg

Recombinant HHV2/HSV2 gD/US6 Protein, C-His

Sign In for Pricing
View Details
Recombinant HHV2/HSV2 gD/US6 Protein, C-His
orb3057277-03 1 mg

Recombinant HHV2/HSV2 gD/US6 Protein, C-His

Sign In for Pricing
View Details
Rat Hs3st3b1 Pre-designed siRNA Set B
SI206421B 1 Each

Rat Hs3st3b1 Pre-designed siRNA Set B

Sign In for Pricing
View Details