Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDDC2 Rabbit Polyclonal Antibody (HRP)

HDDC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf74, CGI-130, NS5ATP2, dJ167O5.2

UniProt

Q7Z4H3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HDDC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EREG Protein Vector (Rat) (pPB-C-His)
PV266506 500 ng

EREG Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
DMBT1 (Deleted in Malignant Brain Tumors 1 Protein, GlycoProtein 340, Gp-340, Hensin, Salivary Agglutinin, SAG, Surfactant Pulmonary-Associated D-Binding Protein, DMBT1, GP340) (MaxLight 490) discontinued
302390-ML490 100 µL

DMBT1 (Deleted in Malignant Brain Tumors 1 Protein, GlycoProtein 340, Gp-340, Hensin, Salivary Agglutinin, SAG, Surfactant Pulmonary-Associated D-Binding Protein, DMBT1, GP340) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human PDZD2 Pre-designed siRNA Set A
SI011946A 1 Each

Human PDZD2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Mouse VSIR/VISTA Polyclonal Antibody
MP543014-01 50 µg

Anti-Mouse VSIR/VISTA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse VSIR/VISTA Polyclonal Antibody
MP543014-02 100 µg

Anti-Mouse VSIR/VISTA Polyclonal Antibody

Sign In for Pricing
View Details
9630033F20Rik Protein Vector (Mouse) (pPM-C-His)
PV150497 500 ng

9630033F20Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details