Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CA Rabbit Polyclonal Antibody (HRP)

PPP1CA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP1A, PP-1A, PPP1A, PP1alpha

UniProt

Q07161

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1CA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCK2 Human Pre-designed siRNA Set A
HY-RS15404 1 Set

UCK2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-01 20 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-02 100 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782P-03 2x 100 Tests

PE/Elab Fluor® 594 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Goat Anti-Human IgA - AF555
BS21684-01 100 µL

Goat Anti-Human IgA - AF555

Sign In for Pricing
View Details
Goat Anti-Human IgA - AF555
BS21684-02 500 µL

Goat Anti-Human IgA - AF555

Sign In for Pricing
View Details