Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CA Rabbit Polyclonal Antibody (HRP)

PPP1CA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP1A, PP-1A, PPP1A, PP1alpha

UniProt

Q07161

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1CA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP4, ID (DPP4, ADCP2, CD26, Dipeptidyl peptidase 4, ADABP, Adenosine deaminase complexing protein 2, Dipeptidyl peptidase IV, T-cell activation antigen CD26, TP103, CD26, Dipeptidyl peptidase 4 membrane form, Dipeptidyl peptidase IV membrane form, Dipeptidyl peptidase 4 soluble form, Dipeptidyl peptidase IV soluble form) (APC) discontinued
034782-APC 200 µL

DPP4, ID (DPP4, ADCP2, CD26, Dipeptidyl peptidase 4, ADABP, Adenosine deaminase complexing protein 2, Dipeptidyl peptidase IV, T-cell activation antigen CD26, TP103, CD26, Dipeptidyl peptidase 4 membrane form, Dipeptidyl peptidase IV membrane form, Dipeptidyl peptidase 4 soluble form, Dipeptidyl peptidase IV soluble form) (APC) discontinued

Sign In for Pricing
View Details
Nefazodone
E4952-5mg 5 mg

Nefazodone

Sign In for Pricing
View Details
CHRNA3 Rabbit pAb, AE conjugated
orb2868548 100 µL

CHRNA3 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
GSTT4 Rabbit Polyclonal Antibody (Biotin)
orb455675 100 µL

GSTT4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Ignition Electrode
1215834 1 Unit

Ignition Electrode

Sign In for Pricing
View Details
STNL W019-297x105-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)
829168 1 Card (1 Panel (s) x 1 Pack)

STNL W019-297x105-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details