Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERHL2 Rabbit Polyclonal Antibody (Biotin)

SERHL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DJ222E13.1

UniProt

Q9H4I8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEHL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055324

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Desmin Chemiluminescent Immunoassay Kit
IHUDESKTC 1 Each

Human Desmin Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21)
309927-01 50 µL

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21)

Sign In for Pricing
View Details
CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21)
309927-02 100 µL

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21)

Sign In for Pricing
View Details
GNAZ Protein Vector (Human) (pPM-C-HA)
PV017995 500 ng

GNAZ Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
POLR2H Antibody / DNA-directed RNA polymerases I, II, and III subunit RPABC3
RQ8029 100 µg

POLR2H Antibody / DNA-directed RNA polymerases I, II, and III subunit RPABC3

Sign In for Pricing
View Details
Human ESS2 qPCR Primer Pair
QH25825S 200 Tests

Human ESS2 qPCR Primer Pair

Sign In for Pricing
View Details