Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA4 Rabbit Polyclonal Antibody (Biotin)

SPACA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAMP14

UniProt

Q8TDM5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_598005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB10P4 Protein Vector (Human) (pPM-C-HA)
PV060659 500 ng

ABCB10P4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human AKT interacting protein (AKTIP) ELISA Kit
MBS7233375-01 48 Well

Human AKT interacting protein (AKTIP) ELISA Kit

Sign In for Pricing
View Details
Human AKT interacting protein (AKTIP) ELISA Kit
MBS7233375-02 96 Well

Human AKT interacting protein (AKTIP) ELISA Kit

Sign In for Pricing
View Details
Human AKT interacting protein (AKTIP) ELISA Kit
MBS7233375-03 5x 96 Well

Human AKT interacting protein (AKTIP) ELISA Kit

Sign In for Pricing
View Details
Human AKT interacting protein (AKTIP) ELISA Kit
MBS7233375-04 10x 96 Well

Human AKT interacting protein (AKTIP) ELISA Kit

Sign In for Pricing
View Details
BAK (Apoptosis Regulator Bak, BCL2-antagonist/killer 1, BAK 1, BAK1, BAK-like, Bak NT, Bcl 2-like 7 Protein, BCL2L7, Cell Death Inhibitor 1, CDN 1, CDN1, MGC117255, MGC3887, NBak, Pro Apoptotic Protein BAK) (MaxLight 650) discontinued
B0055-01P-ML650 100 µL

BAK (Apoptosis Regulator Bak, BCL2-antagonist/killer 1, BAK 1, BAK1, BAK-like, Bak NT, Bcl 2-like 7 Protein, BCL2L7, Cell Death Inhibitor 1, CDN 1, CDN1, MGC117255, MGC3887, NBak, Pro Apoptotic Protein BAK) (MaxLight 650) discontinued

Sign In for Pricing
View Details