Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPACA4 Rabbit Polyclonal Antibody (HRP)

SPACA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAMP14

UniProt

Q8TDM5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_598005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL2 Antibody
orb1240943 100 µL

CCNL2 Antibody

Sign In for Pricing
View Details
Lentiviral human SPATA16 shRNA (UAS) - Lentiviral human SPATA16 shRNA (UAS, GFP) (25)
GTR15090872 1 Vial

Lentiviral human SPATA16 shRNA (UAS) - Lentiviral human SPATA16 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-Human PAPPA Polyclonal Antibody
HC474014-01 50 µg

Anti-Human PAPPA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human PAPPA Polyclonal Antibody
HC474014-02 100 µg

Anti-Human PAPPA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse T-Cell Immunoglobulin and Mucin Domain Containing Protein 4 ELISA Kit
MBS069521-01 48 Well

Mouse T-Cell Immunoglobulin and Mucin Domain Containing Protein 4 ELISA Kit

Sign In for Pricing
View Details
Mouse T-Cell Immunoglobulin and Mucin Domain Containing Protein 4 ELISA Kit
MBS069521-02 96 Well

Mouse T-Cell Immunoglobulin and Mucin Domain Containing Protein 4 ELISA Kit

Sign In for Pricing
View Details