Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2, Human

AKR1C2 Protein, Human is a recombinant human AKR1C2. AKR1C2 is a member of the aldo/keto reductase superfamily and has critical roles in the tumorigenesis and progression of malignant tumours[1].

Product Specifications

Product Name Alternative

AKR1C2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akr1c2-protein-human.html

Purity

96.48

Smiles

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Formula

1646 (Gene_ID) P52895 (M1-Y323) (Accession)

Molecular Weight

Approximately 35.0 kDa

References & Citations

[1]Zhan-Fei Zhang, et al. AKR1C2 acts as a targetable oncogene in esophageal squamous cell carcinoma via activating PI3K/AKT signaling pathway. J Cell Mol Med. 2020 Jul 17.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM4 Polyclonal Antibody
CAC15311-01 50 µg

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
CAC15311-02 100 µg

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
LI-cadherin Double Nickase Plasmid (m2)
sc-419592-NIC-2 20 µg

LI-cadherin Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Sphingosine Kinase Type 2 (SPHK2) Rabbit anti-Human Polyclonal (N-Terminus) Antibody
GWB-EA645C 0.05 mg

Sphingosine Kinase Type 2 (SPHK2) Rabbit anti-Human Polyclonal (N-Terminus) Antibody

Sign In for Pricing
View Details
Indole (standard)
HY-W001132R-01 10 mg

Indole (standard)

Sign In for Pricing
View Details
Indole (standard)
HY-W001132R-02 25 mg

Indole (standard)

Sign In for Pricing
View Details